General Information

  • ID:  hor002022
  • Uniprot ID:  Q28588
  • Protein name:  Progonadoliberin-1
  • Gene name:  GNRH1
  • Organism:  Ovis aries (Sheep)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0033684 regulation of luteinizing hormone secretion; GO:0046880 regulation of follicle-stimulating hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLRPGGKRNAKNVIDSFQEIAKEVDQPVEPKCCGCIVHQSHSPLRDLKAALESLIE
  • Length:  61
  • Propeptide:  QHWSYGLRPGGKRNAKNVIDSFQEIAKEVDQPVEPKCCGCIVHQSHSPLRDLKAALESLIE
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GNRHR
  • Target Unid:  P32237
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q28588-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q28588-F1.pdbhor002022_AF2.pdbhor002022_ESM.pdb

Physical Information

Mass: 789819 Formula: C298H476N88O90S3
Absent amino acids: MT Common amino acids: EKLSAGIPQV
pI: 7.44 Basic residues: 11
Polar residues: 15 Hydrophobic residues: 19
Hydrophobicity: -56.56 Boman Index: -11869
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 83.11
Instability Index: 6390.66 Extinction Coefficient cystines: 7115
Absorbance 280nm: 118.58

Literature

  • PubMed ID:  NA
  • Title:  NA